PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462861517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 473aa    MW: 53487.9 Da    PI: 9.6934
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462861517genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-164286348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT  Ed +l+d v+ +G ++W+ Ia+++  gR +kqc++rw ++l
        462861517 42 PWTHVEDSILKDMVEHHGEKNWTVIAQHLR-GRAGKQCRERWINHL 86
                     8*****************************.************996 PP

2Myb_DNA-binding43.95.3e-14100138545
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      T++Ed+  ++a++ +G++ W+ Ia++++ gR+++ +k++w+
        462861517 100 TEDEDKMVIEAHRYYGNR-WSMIAKHIP-GRSENAIKNHWN 138
                      9*****************.*********.***********8 PP

3Myb_DNA-binding38.23.2e-121902261148
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +l+d v+ +G ++W+ Ia+++  gR +kqc++rw ++l
        462861517 190 ILKDMVEHHGEKNWTVIAQHLR-GRAGKQCRERWINHL 226
                      79********************.************996 PP

4Myb_DNA-binding43.95.3e-14240278545
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      T++Ed+  ++a++ +G++ W+ Ia++++ gR+++ +k++w+
        462861517 240 TEDEDKMVIEAHRYYGNR-WSMIAKHIP-GRSENAIKNHWN 278
                      9*****************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.323590IPR017930Myb domain
SMARTSM007171.3E-143988IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-204089IPR009057Homeodomain-like
SuperFamilySSF466899.18E-2940137IPR009057Homeodomain-like
PfamPF002491.0E-144186IPR001005SANT/Myb domain
CDDcd001671.17E-144286No hitNo description
PROSITE profilePS5129416.45791145IPR017930Myb domain
SMARTSM007173.3E-1195143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-16100142IPR009057Homeodomain-like
CDDcd001675.84E-11100138No hitNo description
PfamPF002493.9E-12100138IPR001005SANT/Myb domain
SMARTSM007175.0E-5183228IPR001005SANT/Myb domain
CDDcd001671.53E-10190226No hitNo description
PfamPF002491.0E-10190226IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-15190231IPR009057Homeodomain-like
SuperFamilySSF466894.08E-24190277IPR009057Homeodomain-like
PROSITE profilePS500908.455191226IPR017877Myb-like domain
PROSITE profilePS5129418.016227285IPR017930Myb domain
SMARTSM007173.3E-11235283IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-16240282IPR009057Homeodomain-like
PfamPF002493.9E-12240278IPR001005SANT/Myb domain
CDDcd001675.84E-11240278No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MPSGALGVTS IDVVGGIPGE AMTARKSQTR SYGKPPAPLK APWTHVEDSI LKDMVEHHGE  60
KNWTVIAQHL RGRAGKQCRE RWINHLRPDL KIMYEVPAIT EDEDKMVIEA HRYYGNRWSM  120
IAKHIPGRSE NAIKNHWNAT MRSLKAKRRQ QKKKSEQVPP GRFSILEEYI RNMYQLVDAV  180
PAAQPPLSTI LKDMVEHHGE KNWTVIAQHL RGRAGKQCRE RWINHLRPDL KIMYEVPAIT  240
EDEDKMVIEA HRYYGNRWSM IAKHIPGRSE NAIKNHWNAT MRSLKAKRRQ QKKKSEQVPP  300
GRFSILEEYI RNMYQLVDAV PAAQPPLSTS PLQNLTYNGL LNPVVDTSTS YSIPTNPEMS  360
FNAGNSVAGS SNPGMINLNM PPLDMNVIGD PQLQLHEYYL NYPMYVPAPA PLLQQATDHE  420
EPQQAYSSLS MSSYIEYFAL LRSETGHTGA SSINPGTDGY YRDPGRGGGG AAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-34362823105B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.11e-72PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS581e-72K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m4e-72(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.14e-37myb domain protein 115